PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_21454
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family TCP
Protein Properties Length: 363aa    MW: 40087.9 Da    PI: 8.8607
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_21454genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP118.86.6e-37421712134
         TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaakskks 100
                  g+kdrhsk+ T++g+RdRRvRls+++a++f+dLqd+LGfd++sk+ieWL+++a  ai el+++ ss +    + +   ++++ ++  a+++  +s+ s
  PEQU_21454  42 SGGKDRHSKVFTSKGLRDRRVRLSVSTAIEFYDLQDRLGFDQPSKAIEWLIKAASSAIAELPSLVSSFP----ELAGGRMNAETGKMIAEAEPGCSSTS 136
                 689*************************************************************33333....22333333334555777788899999 PP

         TCP 101 qksaasalnlak.esrakarararertrekmrikn 134
                 ++s+ s+l+l++ e r kar+rar rt++++  k+
  PEQU_21454 137 ETSKGSVLSLSRsEIRIKARERARLRTAKDKEEKE 171
                 999999******99*************99988775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.4E-3543192IPR005333Transcription factor, TCP
PROSITE profilePS5136931.31444102IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
GO:1903508Biological Processpositive regulation of nucleic acid-templated transcription
GO:2000306Biological Processpositive regulation of photomorphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MEVKRQPSKR SRLSNADKGD EKARTMILSH PSARIFRVSR ASGGKDRHSK VFTSKGLRDR  60
RVRLSVSTAI EFYDLQDRLG FDQPSKAIEW LIKAASSAIA ELPSLVSSFP ELAGGRMNAE  120
TGKMIAEAEP GCSSTSETSK GSVLSLSRSE IRIKARERAR LRTAKDKEEK EEDDGDHLDA  180
TEQHPQNMNQ SSFTQLLIAG SSSERTQIQE ILRPSTVTAD YFGQAGFFAR TQLPSSFCST  240
KGQIFGSYSP VGMMPYNIAA ATGDNSDMQQ FSFINEHMDY NLNFPGFHRG TLQSNPSLHS  300
PFSPSSSSMD VQNVPFFFGA AAPSTEAHFY SICDGRLQLS KEPITPFCLD GYRPPDLKGK  360
RNS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00006PBMTransfer from 493022Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ4396050.0HQ439605.1 Phalaenopsis hybrid cultivar candidate developmental transcription factor TCP3 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008784856.11e-106PREDICTED: transcription factor PCF6-like
RefseqXP_008784857.11e-106PREDICTED: transcription factor PCF6-like
SwissprotQ93V431e-57TCP2_ARATH; Transcription factor TCP2
TrEMBLF5ANW30.0F5ANW3_9ASPA; Candidate developmental transcription factor TCP3 (Fragment)
STRINGGSMUA_Achr4P22960_0011e-69(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30943271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18390.21e-55TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2